PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589696.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 302aa    MW: 34343.5 Da    PI: 4.7959
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589696.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W+++++  g+ R++k+c++rw +yl
   XP_009589696.1 14 KGPWTAEEDKKLINFILNNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.32.6e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++ E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
   XP_009589696.1  71 SEYEEKMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      6779**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-21563IPR009057Homeodomain-like
PROSITE profilePS5129413.754961IPR017930Myb domain
SuperFamilySSF466899.36E-2711108IPR009057Homeodomain-like
SMARTSM007177.8E-121363IPR001005SANT/Myb domain
PfamPF002492.1E-141461IPR001005SANT/Myb domain
CDDcd001671.87E-81661No hitNo description
PROSITE profilePS5129425.60962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2464116IPR009057Homeodomain-like
SMARTSM007173.8E-1466114IPR001005SANT/Myb domain
PfamPF002494.3E-1471111IPR001005SANT/Myb domain
CDDcd001677.84E-1174112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDKKLINFIL NNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEYEEKMVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPVTHKPLS TTITNDQITS IQQPENLPIQ QEKVQEIMPP CTVNDVSIDQ SAITEIKIDD  180
DNDNNKNTGT SCTNNNDIFD STTVEVNNNG FCTDEVPLIE PHEILVPSKS TPSTSSSSSS  240
SSSSYIIEEL KFLPSFDDWP MENNMGFGWE NDFSSTLDFL LNDDNDMNNV TYDESWKFEQ  300
LL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2796120.0AB279612.1 Nicotiana tabacum NtMYBGR1 mRNA for MYB-related transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589696.10.0PREDICTED: protein ODORANT1
RefseqXP_016481534.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX68e-85ODO1_PETHY; Protein ODORANT1
TrEMBLA8CCM90.0A8CCM9_TOBAC; MYB-related transcription factor
STRINGPGSC0003DMT4000404621e-152(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.14e-94myb domain protein 43